Anti-EP4 Receptor (C-term.) conjugated to SureLight APC

Artikelnummer: COBSD3-1866-50

Mengeneinheit: 50 MCG

674.00 CHF 674.0 CHF 674.00 CHF

674.00 CHF

Diese Kombination existiert nicht.

Aktuelle Lieferfrist auf Anfrage

Synonyme: Antibody;Antilichaam;Antibodies;antistoffen;GST-tag;His-tag;IgA;IgD;IgE;IgG;IgM;Immunoglobulin;Isotype control;MAB;PAB;Monoclonal;Polyclonal;dt5d3;Antistof;Anticuerpos;Vasta-aine;iggy antibody selector

Hersteller: COLUMBIA BIOSCIENCES

Herstellernummer: D3-1866-50

Lagertemperatur: Fridge (+4)

Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))

Anti-EP4 Receptor (C-term.) conjugated to SureLight APC

674.00 CHF 674.0 CHF 674.00 CHF

674.00 CHF

Not Available For Sale