Public Pricelist
  1. All Products
  2. VWR / Merck Chemicals
  3. Anti-EP4 receptor (C-term.) conjugated to surelight APC, UoM: 1 * 50 µG

Anti-EP4 receptor (C-term.) conjugated to surelight APC, UoM: 1 * 50 µG

Item Number: COBSD3-1866-50
Unit of Measure: 50 MCG
https://grogg-prod.braintec.cloud/web/image/product.template/1286560/image_1920?unique=f432a5b

674.00 CHF 674.0 CHF 674.00 CHF

674.00 CHF

Not Available For Sale

    This combination does not exist.

    Current delivery time on request
    Contact Us
    Synonyms: Antibody;Antilichaam;Antibodies;antistoffen;GST-tag;His-tag;IgA;IgD;IgE;IgG;IgM;Immunoglobulin;Isotype control;MAB;PAB;Monoclonal;Polyclonal;dt5d3;Antistof;Anticuerpos;Vasta-aine;iggy antibody selector
    Manufacturer: COLUMBIA BIOSCIENCES
    Manufacturer Number: D3-1866-50
    Storage Temperature: Fridge (+4)

    Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))